PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019723m
Common NameCICLE_v10019529mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 522aa    MW: 56144.9 Da    PI: 6.5698
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019723mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.33.1e-24172214244
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       epgrCrRtDGKkWRCsr+v +++k+CErHlhrgr rsrk++e
  Ciclev10019723m 172 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHLHRGRPRSRKPVE 214
                      69**************************************987 PP

2QLQ53.95.6e-19112145235
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                      +FT+aQ+ +L++Q+l+yK+++a++PvP++Ll++ 
  Ciclev10019723m 112 PFTNAQWTELERQALIYKCMVASVPVPSDLLFPF 145
                      8******************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.4E-11111147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.368112147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-12112144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65171215IPR014977WRC domain
PfamPF088791.2E-20173214IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MMSGRIMDAC DFSFINEAAA EEGKVKEAGS NRHRPSPSDE FGWGDAVAGG PTCNNNINNS  60
SSSNHIYKTI GYVSSDSSGS STSMKTLQPF QFDIAAATVN ESPGMAARMG FPFTNAQWTE  120
LERQALIYKC MVASVPVPSD LLFPFTRNRN SAAAAAAPVG LDLIRLSKGG DLEPGRCRRT  180
DGKKWRCSRD VAPDQKYCER HLHRGRPRSR KPVELQPPPN SKKKTRLQSH PLNTTNTVNN  240
SNNNNLDFSA SQFVRNFTQY PHPHVREQRC LDKDWMMRGE AVHLPSNAAG TEWNHLINNP  300
ASPVNINQHY HLEEPLNLNS FASFSAGEAQ QSNDCPFYTD PDLVPRVFID AWSNANGVSN  360
GDDQIHNTNS GTKSSVSSSG NLSLSPLSLS MGGNSTIDEE MGQLQMGLGL VESSQDHKCD  420
TNPQLSSWLN PDSWAPGGPL AEVLRPSTVP ASASGPPSPA AGNGDSDSPP ATTVSSPSGV  480
LQKALVSWSD SSGNSSPTPG SSRTNKSEIA LLWFGQGKLE S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.75310.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441217.10.0hypothetical protein CICLE_v10019529mg
TrEMBLV4TM140.0V4TM14_9R
STRINGPOPTR_0012s02950.11e-102(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-35growth-regulating factor 7